BRN3A Antibody (7B4)
| Name | BRN3A Antibody (7B4) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00005457-M04 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 7B4 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | POU4F1 (NP_006228.2, 331 a.a. - 420 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | POU4F1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: BRN3A Antibody (7B4) [H00005457-M04] - Analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody (M04), clone 7B4. Lane 1: POU4F1 transfected lysatE (46.09 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/17935_BRN3A%2520Antibody%2520(7B4)-Western%2520Blot-H00005457-M04-img0002.jpg)
Western Blot: BRN3A Antibody (7B4) [H00005457-M04] - Analysis of POU4F1 expression in transfected 293T cell line by POU4F1 monoclonal antibody (M04), clone 7B4. Lane 1: POU4F1 transfected lysatE (46.09 KDa). Lane 2: Non-transfected lysate.
![ELISA: BRN3A Antibody (7B4) [H00005457-M04] - Detection limit for recombinant GST tagged POU4F1 is 3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/17936_BRN3A-Antibody-(7B4)-ELISA-H00005457-M04-img0003.jpg)
ELISA: BRN3A Antibody (7B4) [H00005457-M04] - Detection limit for recombinant GST tagged POU4F1 is 3 ng/ml as a capture antibody.