SPRR2F Antibody (5A9)
| Name | SPRR2F Antibody (5A9) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00006705-M03 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 5A9 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | SPRR2F (NP_001014450.1, 1 a.a. - 72 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | SPRR2F |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SPRR2F Antibody (5A9) [H00006705-M03] - Analysis of SPRR2F expression in transfected 293T cell line by SPRR2F monoclonal antibody (M03), clone 5A9. Lane 1: SPRR2F transfected lysatE (7.8 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/9167_SPRR2F%2520Antibody%2520(5A9)-Western%2520Blot-H00006705-M03-img0002.jpg)
Western Blot: SPRR2F Antibody (5A9) [H00006705-M03] - Analysis of SPRR2F expression in transfected 293T cell line by SPRR2F monoclonal antibody (M03), clone 5A9. Lane 1: SPRR2F transfected lysatE (7.8 KDa). Lane 2: Non-transfected lysate.
![Sandwich ELISA: SPRR2F Antibody (5A9) [H00006705-M03] - Detection limit for recombinant GST tagged SPRR2F is 0.1 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/9168_SPRR2F-Antibody-(5A9)-Sandwich-ELISA-H00006705-M03-img0001.jpg)
Sandwich ELISA: SPRR2F Antibody (5A9) [H00006705-M03] - Detection limit for recombinant GST tagged SPRR2F is 0.1 ng/ml as a capture antibody.