IFI6 Antibody
| Name | IFI6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89359 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Mouse |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDE |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IFI6 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: IFI6 Antibody [NBP1-89359] - Staining of human cell line U-2 OS shows positivity in mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/11934_IFI6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89359-img0006.jpg)
Immunocytochemistry/Immunofluorescence: IFI6 Antibody [NBP1-89359] - Staining of human cell line U-2 OS shows positivity in mitochondria.
![Immunohistochemistry-Paraffin: IFI6 Antibody [NBP1-89359] - Human Tumor grafts grown in SCID mice and normal mouse tissues. Image provided by Erin Messick, Repasky/Hylander Lab, Roswell Park Cancer Institute.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/11935_IFI6-Antibody-Immunohistochemistry-Paraffin-NBP1-89359-img0009.jpg)
Immunohistochemistry-Paraffin: IFI6 Antibody [NBP1-89359] - Human Tumor grafts grown in SCID mice and normal mouse tissues. Image provided by Erin Messick, Repasky/Hylander Lab, Roswell Park Cancer Institute.
![Immunohistochemistry-Paraffin: IFI6 Antibody [NBP1-89359] - NBP1-89359 detecting IFI6 in mouse intestine. Image provided by Erin Messick, Repasky/Hylander Lab, Roswell Park Cancer Institute.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/11936_IFI6-Antibody-Immunohistochemistry-Paraffin-NBP1-89359-img0007.jpg)
Immunohistochemistry-Paraffin: IFI6 Antibody [NBP1-89359] - NBP1-89359 detecting IFI6 in mouse intestine. Image provided by Erin Messick, Repasky/Hylander Lab, Roswell Park Cancer Institute.
![Immunohistochemistry-Paraffin: IFI6 Antibody [NBP1-89359] - Staining of human rectum shows strong cytoplasmic positivity in granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/11937_IFI6-Antibody-Immunohistochemistry-Paraffin-NBP1-89359-img0008.jpg)
Immunohistochemistry-Paraffin: IFI6 Antibody [NBP1-89359] - Staining of human rectum shows strong cytoplasmic positivity in granular pattern in glandular cells.