G6PC Antibody
| Name | G6PC Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59361 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Guinea Pig, Sheep |
| Antigen | Synthetic peptides corresponding to G6PC(glucose-6-phosphatase, catalytic subunit) The peptide sequence was selected from the N terminal of G6PC. Peptide sequence NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | G6PC |
| Supplier Page | Shop |
Product images
![Western Blot: G6PC Antibody [NBP1-59361] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/11939_G6PC-Antibody-Western-Blot-NBP1-59361-img0005.jpg)
Western Blot: G6PC Antibody [NBP1-59361] - Sample Tissue: Human Fetal Lung, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
![Immunohistochemistry-Paraffin: G6PC Antibody [NBP1-59361] - Human kidney Tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/11940_G6PC-Antibody-Immunohistochemistry-Paraffin-NBP1-59361-img0002.jpg)
Immunohistochemistry-Paraffin: G6PC Antibody [NBP1-59361] - Human kidney Tissue.
![Western Blot: G6PC Antibody [NBP1-59361] - Titration: 1 ug/ml Positive Control: Fetal Lung cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/11941_G6PC-Antibody-Western-Blot-NBP1-59361-img0003.jpg)
Western Blot: G6PC Antibody [NBP1-59361] - Titration: 1 ug/ml Positive Control: Fetal Lung cell lysate.