SLC6A14 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59659
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC6A14(solute carrier family 6 (amino acid transporter), member 14) The peptide sequence was selected from the middle region of SLC6A14. Peptide sequence VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGP
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC6A14
• Conjugate: Unconjugated