VISTA/B7-H5/PD-1H Antibody

Name VISTA/B7-H5/PD-1H Antibody
Supplier Novus Biologicals
Catalog NBP1-59540
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Dog, Horse
Antigen Synthetic peptides corresponding to C10ORF54 The peptide sequence was selected from the N terminal of C10ORF54 (NP_071436). Peptide sequence TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene C10orf54
Supplier Page Shop

Product images