Name | VISTA/B7-H5/PD-1H Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59540 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Bovine, Dog, Horse |
Antigen | Synthetic peptides corresponding to C10ORF54 The peptide sequence was selected from the N terminal of C10ORF54 (NP_071436). Peptide sequence TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE. |
Purity/Format | Affinity purified |
Description | Rabbit Polyclonal |
Gene | C10orf54 |
Supplier Page | Shop |