Name | Glucose Transporter GLUT6 Antibody [Alexa Fluor (R) 405] |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59891AF405 |
Prices | $379.00 |
Sizes | 100 tests |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLT |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | SLC2A6 |
Conjugate | Alexa Fluor (R) 405 |
Supplier Page | Shop |