Glucose Transporter GLUT6 Antibody [Alexa Fluor (R) 405]

• Supplier: Novus Biologicals
• Catalog: NBP1-59891AF405
• Prices: $379.00
• Sizes: 100 tests
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLT
• Purity/Format: IgG purified
• Description: Rabbit Polyclonal
• Gene: SLC2A6
• Conjugate: Alexa Fluor (R) 405