Neuronatin Antibody (1B9)

Name Neuronatin Antibody (1B9)
Supplier Novus Biologicals
Catalog H00004826-M01
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 1B9
Applications ELISA
Species Reactivities Human
Antigen NNAT (NP_005377.1, 22 a.a. - 81 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN
Purity/Format Protein A purified
Description Mouse Monoclonal
Gene NNAT
Conjugate Unconjugated
Supplier Page Shop

Product images