PRL-2/PTP4A2 Antibody (3C2)
| Name | PRL-2/PTP4A2 Antibody (3C2) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00008073-M07 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 3C2 |
| Applications | ELISA |
| Species Reactivities | Human |
| Antigen | PTP4A2 (NP_003470.1, 1 a.a. - 95 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGC |
| Purity/Format | Protein A purified |
| Description | Mouse Monoclonal |
| Gene | PTP4A2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: PRL-2/PTP4A2 Antibody (3C2) [H00008073-M07] - Detection limit for recombinant GST tagged PTP4A2 is 0.03 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/21921_PRL-2-PTP4A2%2520Antibody%2520(3C2)-Sandwich%2520ELISA-H00008073-M07-img0001.jpg)
Sandwich ELISA: PRL-2/PTP4A2 Antibody (3C2) [H00008073-M07] - Detection limit for recombinant GST tagged PTP4A2 is 0.03 ng/ml as a capture antibody.