ATP5I Antibody (1E6.)

• Supplier: Novus Biologicals
• Catalog: H00000521-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 1E6.
• Applications: ELISA
• Species Reactivities: Human
• Antigen: ATP5I (AAH03679, 1 a.a. - 69 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: ATP5I
• Conjugate: Unconjugated