Name | ATP5I Antibody (1E6.) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00000521-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1E6. |
Applications | ELISA |
Species Reactivities | Human |
Antigen | ATP5I (AAH03679, 1 a.a. - 69 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | ATP5I |
Conjugate | Unconjugated |
Supplier Page | Shop |