Name | NDUFA1 Antibody (2A4) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00004694-M10 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 2A4 |
Applications | ELISA |
Species Reactivities | Human |
Antigen | NDUFA1 (AAH00266, 1 a.a. - 70 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | NDUFA1 |
Conjugate | Unconjugated |
Supplier Page | Shop |