NDUFA1 Antibody (2A4)

• Supplier: Novus Biologicals
• Catalog: H00004694-M10
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone: 2A4
• Applications: ELISA
• Species Reactivities: Human
• Antigen: NDUFA1 (AAH00266, 1 a.a. - 70 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: NDUFA1
• Conjugate: Unconjugated