ZNF69 Antibody (1E3.)
| Name | ZNF69 Antibody (1E3.) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007620-M08 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1E3. |
| Applications | ELISA |
| Species Reactivities | Human |
| Antigen | ZNF69 (NP_068734.1, 1 a.a. - 81 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPCCSHRRCREDPGTSESQEMEEWALLDISQRKLYKEVMLETFRNLTSVGKSWKDQNIEYEYQNPRRNFRSLIEKKVNEIK |
| Purity/Format | Protein A purified |
| Description | Mouse Monoclonal |
| Gene | ZNF69 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: ZNF69 Antibody (1E3) [H00007620-M08] - Detection limit for recombinant GST tagged ZNF69 is 0.3 ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/21747_ZNF69%2520Antibody%2520(1E3)-Sandwich%2520ELISA-H00007620-M08-img0001.jpg)
Sandwich ELISA: ZNF69 Antibody (1E3) [H00007620-M08] - Detection limit for recombinant GST tagged ZNF69 is 0.3 ng/ml as a capture antibody.