AGPAT9 Antibody
| Name | AGPAT9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93692 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ILVKTLEWATIRIEKGTPKESILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEELVSWNLLTRTN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | AGPAT9 Protein |
| Description | Rabbit Polyclonal |
| Gene | AGPAT9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: AGPAT9 Antibody [NBP1-93692] - Analysis in human cell line CAPAN-2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16378_AGPAT9-Antibody-Western-Blot-NBP1-93692-img0006.jpg)
Western Blot: AGPAT9 Antibody [NBP1-93692] - Analysis in human cell line CAPAN-2.
![Immunohistochemistry-Paraffin: AGPAT9 Antibody [NBP1-93692] - Staining of human duodenum shows strong cytoplasmic positivity with a granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16379_AGPAT9-Antibody-Immunohistochemistry-Paraffin-NBP1-93692-img0007.jpg)
Immunohistochemistry-Paraffin: AGPAT9 Antibody [NBP1-93692] - Staining of human duodenum shows strong cytoplasmic positivity with a granular pattern in glandular cells.
![Immunohistochemistry-Paraffin: AGPAT9 Antibody [NBP1-93692] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16380_AGPAT9-Antibody-Immunohistochemistry-Paraffin-NBP1-93692-img0002.jpg)
Immunohistochemistry-Paraffin: AGPAT9 Antibody [NBP1-93692] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.