SLC25A1 Antibody
| Name | SLC25A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85382 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNP |
| Blocking Peptide | SLC25A1 Protein |
| Description | Rabbit Polyclonal |
| Gene | SLC25A1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: SLC25A1 Antibody [NBP1-85382] - Staining of human lateral ventricle shows strong granular cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/14400_SLC25A1-Antibody-Immunohistochemistry-NBP1-85382-img0003.jpg)
Immunohistochemistry: SLC25A1 Antibody [NBP1-85382] - Staining of human lateral ventricle shows strong granular cytoplasmic positivity in neuronal cells.