Anti-ACADS antibody
| Name | Anti-ACADS antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87544 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Drosophila, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 144-193 ( TSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEAS ) of Human ACADS (NP_000008) |
| Description | Rabbit Polyclonal |
| Gene | ACADS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ACADS antibody (ab87544) at 1 µg/ml + Fetal intestine lysate (Human) at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution