Anti-Aconitase 2 antibody
| Name | Anti-Aconitase 2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83528 |
| Prices | $394.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF ICC/IF ELISA IHC-P WB |
| Species Reactivities | Mouse, Human, C. elegans, Rat, Chicken, Bovine, Dog, Pig, Yeast, Drosophila, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 648-697 ( RYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHET ) of human ACO2 (NP_001089) |
| Description | Rabbit Polyclonal |
| Gene | ACO2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pineal tissue labelling Aconitase 2 with ab83528 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm of the cell bodies of penealocytes and connective tissue (septum). Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - Aconitase 2. Right - Merge.
Anti-Aconitase 2 antibody (ab83528) at 1 µg/ml (in 5% skim milk/ PBS) + 721_B cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
ICC/IF image of ab83528 stained HepG2 cells. The cells were 4% formaldehyde (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab83528, 1µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899 Dylight 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.