Anti-ACSF2 antibody
| Name | Anti-ACSF2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113912 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 403-452 ( DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL ) of Human ACSF2 (NP_079425) |
| Description | Rabbit Polyclonal |
| Gene | ACSF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ACSF2 antibody (ab113912) at 1 µg/ml + Human fetal lung lysate at 10 µg