Anti-ACTR10 antibody
| Name | Anti-ACTR10 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99148 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 287-336 ( SLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKAL ) of Human ACTR10 (NP_060947) |
| Description | Rabbit Polyclonal |
| Gene | ACTR10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ACTR10 antibody (ab99148) at 1 µg/ml + 293T Cell Lysate at 10 µg