Anti-ADA2a antibody
| Name | Anti-ADA2a antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab22175 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Fusion protein: NFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQAGIDS GLSPSIPMASNSGRRSAPPLNLTG , corresponding to amino acids 296/369 of Human ADA2a Run BLAST with Run BLAST with |
| Description | Mouse Polyclonal |
| Gene | TADA2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
All lanes : Anti-ADA2a antibody (ab22175) at 1/1000 dilutionLane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ugLane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ugSecondaryRabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution