Anti-ADAD2 antibody
| Name | Anti-ADAD2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab105956 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Rabbit, Horse, Bovine, Cat, Pig |
| Antigen | Synthetic peptide corresponding to a region within amino acids 359-408 ( GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP ) of Human ADAD2 (NP_631913) |
| Description | Rabbit Polyclonal |
| Gene | ADAD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ADAD2 antibody (ab105956) at 0.5 µg/ml + Human Liver Cell Lysate at 10 µg