Anti-Adenine Nucleotide Translocase 1 antibody
| Name | Anti-Adenine Nucleotide Translocase 1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102032 |
| Prices | $388.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P ICC/IF ICC/IF |
| Species Reactivities | Mouse, Rat, Human, Sheep, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 ( LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT ) of Human Adenine Nucleotide Translocase 1 (NP_001142) |
| Description | Rabbit Polyclonal |
| Gene | SLC25A4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human pineal tissue labelling Adenine Nucleotide Translocase 1 with ab102032 at 1/100. A Cy3-conjugated donkey anti-rabbit IgG (1/200) was used as the secondary antibody. Positive staining shown in the cytoplasm of cell bodies of pinealocytes and their processes. Magnification: 20X. Exposure time: 0.5 - 2.0 seconds. Left - DAPI. Middle - Adenine Nucleotide Translocase 1. Right - Merge.
Anti-Adenine Nucleotide Translocase 1 antibody (ab102032) at 1 µg/ml + RPMI-8226 Cell Lysate at 10 µg