Name | Anti-ALDH1B1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab86382 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Chicken, Guinea Pig, Bovine, Dog, Pig, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 396 - 445 ( FFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLA ) of Human ALDH1B1 (NP_000683) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | ALDH1B1 |
Conjugate | Unconjugated |
Supplier Page | Shop |