Anti-ALDH1B1 antibody
| Name | Anti-ALDH1B1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86382 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Chicken, Guinea Pig, Bovine, Dog, Pig, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 396 - 445 ( FFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLA ) of Human ALDH1B1 (NP_000683) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ALDH1B1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ALDH1B1 antibody (ab86382) at 1 µg/ml + HeLa cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution