Anti-alpha COP I antibody
| Name | Anti-alpha COP I antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab104710 |
| Prices | $384.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC-P ICC/IF ICC/IF |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Yeast, C. elegans, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within amino acids 22-71 ( PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD ) of Human alpha COP I (NP_004362) |
| Description | Rabbit Polyclonal |
| Gene | COPA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
IHC image of alpha COP I staining in Human skin melanoma formalin fixed paraffin embedded tissue section, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab104710, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX. For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.
Anti-alpha COP I antibody (ab104710) at 0.5 µg/ml + HeLa cell lysate at 10 µg
ab104710 stained MCF-7 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab104710 at 5µg/ml overnight at +4°C. The secondary antibody (green) was DyLight® 488 goat anti- rabbit (ab96899) IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.