Anti-ALPPL2 antibody
| Name | Anti-ALPPL2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99177 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Chicken, Bovine, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 431-480 ( SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV ) of human ALPPL2 (NP_112603) |
| Description | Rabbit Polyclonal |
| Gene | ALPPL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ALPPL2 antibody (ab99177) at 1 µg/ml + OVCAR-3 cell lysate at 10 µgSecondaryGoat Anti-Rabbit IgG Antibody (HRP-Conjugated)