Name | Anti-ALPPL2 antibody |
---|---|
Supplier | Abcam |
Catalog | ab99177 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Chicken, Bovine, Dog, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within internal amino acids 431-480 ( SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV ) of human ALPPL2 (NP_112603) |
Description | Rabbit Polyclonal |
Gene | ALPPL2 |
Conjugate | Unconjugated |
Supplier Page | Shop |