Anti-ALS2CR12 antibody
| Name | Anti-ALS2CR12 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83040 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the N-terminal amino acids 35-84 ( SSKLTPLVPAPKNHNYLQPTKPVVSPKMKIHSARQEETNKSFYEVINVSP )of Human ALS2CR12 (NP_631902) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ALS2CR12 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ALS2CR12 antibody (ab83040) at 1 µg/ml (HRP conjugated anti-Rabbit IgG ) + MCF7 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution