Anti-AMH antibody [5/6]
| Name | Anti-AMH antibody [5/6] |
|---|---|
| Supplier | Abcam |
| Catalog | ab24542 |
| Prices | $382.00 |
| Sizes | 100 µl |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 |
| Clone | 5/6 |
| Applications | IHC-P |
| Species Reactivities | Mouse, Sheep, Human, Monkey, Rat, Bovine, Pig |
| Antigen | Synthetic peptide: VPTAYAGKLLISLSEERISAHHVPNMVATEC , corresponding to C terminal amino acids 527-557 of Human AMH |
| Description | Mouse Monoclonal |
| Gene | AMH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Ab24542, at a dilution of 1/20 to 1/40, staining formalin fixed paraffin embedded ovary tissue from a 25 day old mouse by Immunohystochemistry.
Product References
Serum anti-mullerian hormone levels reflect the size of the primordial follicle - Serum anti-mullerian hormone levels reflect the size of the primordial follicle
Kevenaar ME, Meerasahib MF, Kramer P, van de Lang-Born BM, de Jong FH, Groome NP, Themmen AP, Visser JA. Endocrinology. 2006 Jul;147(7):3228-34. Epub 2006 Mar 23.
Anti-Mullerian hormone expression pattern in the human ovary: potential - Anti-Mullerian hormone expression pattern in the human ovary: potential
Weenen C, Laven JS, Von Bergh AR, Cranfield M, Groome NP, Visser JA, Kramer P, Fauser BC, Themmen AP. Mol Hum Reprod. 2004 Feb;10(2):77-83.
Anti-Mullerian hormone and its role in ovarian function. - Anti-Mullerian hormone and its role in ovarian function.
Gruijters MJ, Visser JA, Durlinger AL, Themmen AP. Mol Cell Endocrinol. 2003 Dec 15;211(1-2):85-90.