Anti-ANKRD13B antibody

Name Anti-ANKRD13B antibody
Supplier Abcam
Catalog ab85577
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Mouse, Rat, Guinea Pig, Bovine, Cat, Dog
Antigen Synthetic peptide corresponding to a region within the middle amino acids 540-589 ( HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ ) of Human ANKRD13B (NP_689558) Run BLAST with Run BLAST with
Description Rabbit Polyclonal
Gene ANKRD13B
Conjugate Unconjugated
Supplier Page Shop

Product images