Anti-ANKRD13B antibody
| Name | Anti-ANKRD13B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85577 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within the middle amino acids 540-589 ( HPMSYEGRRQDRSAPPTPQRQPAPPASVPSPRPSSGPGSGGHVFRSYDEQ ) of Human ANKRD13B (NP_689558) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | ANKRD13B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ANKRD13B antibody (ab85577) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal heart lysate (human) at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution