Anti-ANKRD50 antibody
| Name | Anti-ANKRD50 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab125317 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 1146-1195 ( LQPSLRGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTT ) of Rat ANKRD50 (NP_001178535 |
| Description | Rabbit Polyclonal |
| Gene | ANKRD50 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ANKRD50 antibody (ab125317) at 1 µg/ml + Rat lung lysate at 10 µg