Name | Anti-ANKRD50 antibody |
---|---|
Supplier | Abcam |
Catalog | ab125317 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Rat, Mouse, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human, Zebrafish |
Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 1146-1195 ( LQPSLRGLPNGPAHAFSSPSESPDSTVDRQKSSLSNNSLKSSKNSSLRTT ) of Rat ANKRD50 (NP_001178535 |
Description | Rabbit Polyclonal |
Gene | ANKRD50 |
Conjugate | Unconjugated |
Supplier Page | Shop |