Anti-ANKRD7 antibody
| Name | Anti-ANKRD7 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81309 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to an internal region within amino acids 109-158 (ILLNFGADPDLRDIRYNTVLHYAVCGQSLSLVEKLLEYEADLEAKNKDG Y) of Human ANKRD7, NP_001071176 |
| Description | Rabbit Polyclonal |
| Gene | ANKRD7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ANKRD7 antibody (ab81309) at 1 µg/ml (in 5% skim milk / PBS buffer) + Placental lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution