Anti-Apolipoprotein H antibody
| Name | Anti-Apolipoprotein H antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99123 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Mouse, Rat, Guinea Pig, Pig, Chimpanzee |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 143-192 ( PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG ) of Human Apolipoprotein H (NP_000033) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | APOH |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
