Anti-APRT antibody
| Name | Anti-APRT antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84286 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Guinea Pig |
| Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 1 - 50 (ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHL K) of Human APRT, (NP_000476) |
| Description | Rabbit Polyclonal |
| Gene | APRT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-APRT antibody (ab84286) at 1 µg/ml (in 5% skim milk / PBS buffer) + 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution