Name | Anti-APRT antibody |
---|---|
Supplier | Abcam |
Catalog | ab84286 |
Prices | $370.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Guinea Pig |
Antigen | Synthetic peptide, corresponding to a region within N terminal amino acids 1 - 50 (ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHL K) of Human APRT, (NP_000476) |
Description | Rabbit Polyclonal |
Gene | APRT |
Conjugate | Unconjugated |
Supplier Page | Shop |