Anti-Aquaporin 10 antibody
| Name | Anti-Aquaporin 10 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab81179 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | A synthetic peptide within C terminal amino acids 253-302 of Human AQP10 ( GATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL ) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | AQP10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Aquaporin 10 antibody (ab81179) at 1 µg/ml + Jurkat Cell Lysate at 10 µg