Anti-ARL17B antibody
| Name | Anti-ARL17B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94438 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 108-157 (CSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD L) of Human ARL17B (NP_001034172) |
| Description | Rabbit Polyclonal |
| Gene | ARL17B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ARL17B antibody (ab94438) at 1 µg/ml + Placenta lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution