Anti-ARSE antibody
| Name | Anti-ARSE antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83458 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 503-552 (KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTL S) of Human ARSE (NP_000038) |
| Description | Rabbit Polyclonal |
| Gene | ARSE |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ARSE antibody (ab83458) at 1 µg/ml + placenta lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution