Anti-ASPRV1 antibody

Name Anti-ASPRV1 antibody
Supplier Abcam
Catalog ab87168
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Rat, Horse, Guinea Pig
Antigen Synthetic peptide corresponding to internal sequence amino acids 144 - 193 ( GEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSMG ) of Human ASPRV1 (NP_690005) Run BLAST with Run BLAST with
Description Rabbit Polyclonal
Gene ASPRV1
Conjugate Unconjugated
Supplier Page Shop

Product images