Name | Anti-ASPRV1 antibody |
---|---|
Supplier | Abcam |
Catalog | ab87168 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Rat, Horse, Guinea Pig |
Antigen | Synthetic peptide corresponding to internal sequence amino acids 144 - 193 ( GEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSMG ) of Human ASPRV1 (NP_690005) Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | ASPRV1 |
Conjugate | Unconjugated |
Supplier Page | Shop |