Anti-ATCAY antibody
| Name | Anti-ATCAY antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab113923 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Horse, Chicken, Bovine, Cat, Dog, Pig, Yeast |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 308-357 ( LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN ) of Human ATCAY (NP_149053) |
| Description | Rabbit Polyclonal |
| Gene | ATCAY |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ATCAY antibody (ab113923) at 1 µg/ml + ACHN cell lysate at 10 µg