Anti-ATCAY antibody - C-terminal
| Name | Anti-ATCAY antibody - C-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab135324 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 321-370 ( LQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETSM ) of Human ATCAY (NP_149053) |
| Description | Rabbit Polyclonal |
| Gene | ATCAY |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-ATCAY antibody - C-terminal (ab135324) at 1 µg/ml + Human fetal thymus lysate at 10 µg