Anti-Axotrophin antibody
| Name | Anti-Axotrophin antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab84130 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within middle amino acids 287-336 ( SSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVP ) of Human Axotrophin (NP_073737) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | MARCH7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Axotrophin antibody (ab84130) at 1 µg/ml + Placental lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution