Anti-BAPX1 antibody
| Name | Anti-BAPX1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85429 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rabbit, Chicken, Guinea Pig, Bovine, Dog |
| Antigen | A synthetic peptide corresponding to a region within the N terminal amino acids 2-51( AVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCC ) of Human BAPX1, NP_001180 |
| Description | Rabbit Polyclonal |
| Gene | NKX3-2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-BAPX1 antibody (ab85429) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution