Name | Anti-BCL6B antibody |
---|---|
Supplier | Abcam |
Catalog | ab87228 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 432-481 (VRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP ) of Human BCL6B (NP_862827) |
Description | Rabbit Polyclonal |
Gene | BCL6B |
Conjugate | Unconjugated |
Supplier Page | Shop |