Anti-BCL6B antibody
| Name | Anti-BCL6B antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87228 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 432-481 (VRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP ) of Human BCL6B (NP_862827) |
| Description | Rabbit Polyclonal |
| Gene | BCL6B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-BCL6B antibody (ab87228) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution