Anti-beta Defensin 1 antibody [M11-14b-D10]

• Supplier: Abcam
• Catalog: ab14425
• Prices: $370.00
• Sizes: 50 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone: M11-14b-D10
• Applications: ELISA WB IHC-P
• Species Reactivities: Human, Chimpanzee, Monkey, Monkey
• Antigen: Synthetic peptide: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK , corresponding to amino acids 1-36 of Human beta 1 Defensin
• Description: Mouse Monoclonal
• Gene: DEFB1
• Conjugate: Unconjugated

Product images

ab14425 (2µg/ml) staining beta defensin in human kidney, using an automated system (DAKO Autostainer Plus). Using this protocol there is strong staining in the epithelial layers of the loops of Henle, distal tubules and collecting ducts.Sections were rehydrated and antigen retrieved with the Dako 3 in 1 AR buffer EDTA pH 9.0 in a DAKO PT link. Slides were peroxidase blocked in 3% H2O2 in methanol for 10 mins. They were then blocked with Dako Protein block for 10 minutes (containing casein 0.25% in PBS) then incubated with primary antibody for 20 min and detected with Dako envision flex amplification kit for 30 minutes. Colorimetric detection was completed with Diaminobenzidine for 5 minutes. Slides were counterstained with Haematoxylin and coverslipped under DePeX. Please note that, for manual staining, optimization of primary antibody concentration and incubation time is recommended. Signal amplification may be required.

Product References

Human beta-defensin-1 suppresses tumor migration and invasion and is an - Human beta-defensin-1 suppresses tumor migration and invasion and is an

Han Q, Wang R, Sun C, Jin X, Liu D, Zhao X, Wang L, Ji N, Li J, Zhou Y, Ye L, Liang X, Jiang L, Liao G, Dan H, Zeng X, Chen Q. PLoS One. 2014 Mar 21;9(3):e91867.

Proteinase 3 carries small unusual carbohydrates and associates with - Proteinase 3 carries small unusual carbohydrates and associates with

Zoega M, Ravnsborg T, Hojrup P, Houen G, Schou C. J Proteomics. 2012 Feb 16;75(5):1472-85.