Anti-BEX4 antibody - N-terminal
| Name | Anti-BEX4 antibody - N-terminal |
|---|---|
| Supplier | Abcam |
| Catalog | ab136317 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Horse |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 28-77 ( PTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEAR ) of Human BEX4 (NM_001127688) |
| Description | Rabbit Polyclonal |
| Gene | BEX4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-BEX4 antibody - N-terminal (ab136317) at 1 µg/ml + HCT15 cell lysate at 10 µgSecondarystandard HRP-labelled anti-rabbit