Anti-BIGM103 antibody
| Name | Anti-BIGM103 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99099 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 107-156 ( QLNFHPCEDRPKHKTRPSHSEWGYGFLSVTIINLASLLGLILTPLIKKS ) of Human BIGM103 (NP_071437 ) |
| Description | Rabbit Polyclonal |
| Gene | SLC39A8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-BIGM103 antibody (ab99099) at 1 µg/ml + NCI-H226 cell lysate at 10 µg