Name | Anti-BTBD3 antibody |
---|---|
Supplier | Abcam |
Catalog | ab85841 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Guinea Pig, Bovine, Cat, Dog, Pig |
Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (VDDKEKNMKCLTFFLMLPETVKNRSKKSSKKANTSSSSSNSSKLPPVCY E) of Human BTBD3 (NP_055777) |
Description | Rabbit Polyclonal |
Gene | BTBD3 |
Conjugate | Unconjugated |
Supplier Page | Shop |