Anti-C10orf30 antibody
| Name | Anti-C10orf30 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102622 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 107-156 ( AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR ) of Human C10orf30 (NP_689964) |
| Description | Rabbit Polyclonal |
| Gene | BEND7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C10orf30 antibody (ab102622) at 1 µg/ml + HT1080 cell lysate at 10 µg