Anti-C10orf57 antibody
| Name | Anti-C10orf57 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85395 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide designed within residues: QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH , corresponding to internal amino acids 36-85 of Human C10orf57 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | TMEM254 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C10orf57 antibody (ab85395) at 1 µg/ml + HeLa cell lysate at 10 µg