Name | Anti-C10orf57 antibody |
---|---|
Supplier | Abcam |
Catalog | ab85395 |
Prices | $370.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Bovine, Cat, Dog |
Antigen | Synthetic peptide designed within residues: QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH , corresponding to internal amino acids 36-85 of Human C10orf57 Run BLAST with Run BLAST with |
Description | Rabbit Polyclonal |
Gene | TMEM254 |
Conjugate | Unconjugated |
Supplier Page | Shop |