Anti-C11orf42 antibody
| Name | Anti-C11orf42 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122967 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Horse, Guinea Pig, Bovine, Cat |
| Antigen | Synthetic peptide corresponding to a region within C-terminal amino acids 259-308 (PTPPPQEGPEDKPTRFSYKGRNPFWRGPQILSENWLFSPRSPPPGAQGG G) of Human C11orf42 (NP_775796) |
| Description | Rabbit Polyclonal |
| Gene | C11orf42 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C11orf42 antibody (ab122967) at 1 µg/ml + MCF7 cell lysate at 10 µg