Anti-C11orf49 antibody
| Name | Anti-C11orf49 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122646 |
| Prices | $443.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P ICC/IF ICC/IF |
| Species Reactivities | Human |
| Antigen | antigen sequence: VIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLCDRHKYSCPPPA LVKEALSNVQ RLTFYGFLMALSKHRGINQAL, corresponding to amino acids 172-252 of Human C11orf49 (Q9H6J7) |
| Description | Rabbit Polyclonal |
| Gene | C11orf49 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
