Anti-C11orf74 antibody
| Name | Anti-C11orf74 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab83490 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide, corresponding to a region within internal sequence amino acids 171-220 (VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSC D) of Human C11orf74, (NP_620142) |
| Description | Rabbit Polyclonal |
| Gene | C11orf74 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-C11orf74 antibody (ab83490) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal muscle lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 50000