Anti-C12orf23 antibody
| Name | Anti-C12orf23 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122784 |
| Prices | $443.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P ICC/IF ICC/IF |
| Species Reactivities | Human |
| Antigen | antigen sequence: QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR, corresponding to N terminal amino acids 8-37 of Human C12orf23 |
| Description | Rabbit Polyclonal |
| Gene | TMEM263 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
